Nusrat Fateh Ali Khan Songs & Qawali APK - v1.0

2+ votes, 5.00/5

... [readmore]


⇣ Download APK (4.20 MB)

This is an original APK file direct fetch from google play. It is safe to download and free of any virus.

Version 1.0
Update
Size 4.20 MB
Category Entertainment
Developer Active App
Downloads ↓ 0
⇣ Download APK (4.20 MB)

This is an original APK file direct fetch from google play. It is safe to download and free of any virus.

Basic Infos

License type Free
Version 1.0
Size 4.20 MB (4404675)
Filename com.activeapp.nusratfatehalikhanqawwali_1_4404675.apk
Requirement 2.3.3 and up
Type app
Category Entertainment
Package name: com.activeapp.nusratfatehalikhanqawwali
Slogan:

App Permissions (inside APK file)


‣ android.permission.INTERNET
‣ android.permission.ACCESS_NETWORK_STATE
‣ android.permission.ACCESS_WIFI_STATE
‣ android.permission.WRITE_EXTERNAL_STORAGE
‣ android.permission.WAKE_LOCK
‣ com.activeapp.nusratfatehalikhanqawwali.permission.C2D_MESSAGE
‣ com.google.android.c2dm.permission.RECEIVE
‣ android.permission.VIBRATE
‣ android.permission.ACCESS_COARSE_LOCATION
‣ android.permission.ACCESS_FINE_LOCATION
‣ android.permission.RECEIVE_BOOT_COMPLETED
‣ android.permission.BLUETOOTH


Features used


‣ android.hardware.location
‣ android.hardware.location.gps
‣ android.hardware.location.network
‣ android.hardware.bluetooth
‣ android.hardware.wifi
‣ android.hardware.touchscreen

Screenshots (6 images)

Nusrat Fateh Ali Khan Songs & Qawali screenshot 1 Nusrat Fateh Ali Khan Songs & Qawali screenshot 2 Nusrat Fateh Ali Khan Songs & Qawali screenshot 3 Nusrat Fateh Ali Khan Songs & Qawali screenshot 4 Nusrat Fateh Ali Khan Songs & Qawali screenshot 5 Nusrat Fateh Ali Khan Songs & Qawali screenshot 6

About Nusrat Fateh Ali Khan Songs & Qawali APK

Nusrat Fateh Ali Khan Songs & Qawali poster
Nusrat Fateh Ali Khan Songs & Qawali APK version 1.0 poster

Latest update


1. More Songs & Qawwali Added
2. Sound & Video Quality Improved
3. All Bugs Fixed

Nusrat Fateh Ali Khan Songs & Qawali APK Description


Watch and listen Qawallis sung by Nusrat Fateh Ali khan in this app “Nusrat Fateh Ali Khan Qawallis”.

The app “Nusrat Fateh Ali Khan Qawallis” is the featured app with all the best features brought for our dear customers and the die hearted fans of Nusrat Fateh Ail khan. This app is great for his fans as it is simple and easy to use, user friendly interface; you can play it in offline mode also and can work on 2G and 3G networks. Just download and install free app “Nusrat Fateh Ali Khan Qawallis” to enjoy popular and hit Qawallis sung by him.

In this app “Nusrat Fateh Ali Khan Qawallis” you can get the best collection of Nusrat's hits including Dum Mastt, Kinna Sohna Tainu, Mera Piya Ghar Aaya, Sanu Ek Pal Chain Na Aawe, Allah Hoo Allah Hoo, Yeh Jo Halka Halka Suroor Hai,Tumhen Dillagi Bhool Jaani Padegi, Ali Ali Ali Maula Ali Ali, Ali Dum Dum De Ander, Sanson Ki Maala Pe Simrun Main, Yeh Jo Halka Halka Suroor Hai and many more best collections.
1. Classical Music
2. Nusrat Fateh Ali Khan Qawwali
3. classical songs
4. Folk songs in punjabi
5. Sabri Qawwal
6. Sabri Brother Qawwali
7. Golden Music
8. Attaullah khan all song
9. Saraiki Songs
10. Allah Ditta Lonay Wala
11. Ustad Amanat Ali Khan
12. Gulam Ali Gazal
13. Mehdi Hassan Ghazal
14. Noor Jahan Songs
15. Sultan Rahi
16. Rangeela Songs
17. Naat Sharif
18. Data Ali Hajveri Book
19. Baba farid ganj shakar
20. Heer Ranjha By Waris Shah
21. Heer waris shah kalam
22. Kalam Mian Muhammad Bakhsh
23. Baba Bulleh Shah
24. Allama Iqbal Ghazal
25. Mirza Ghalib Ghazals
26. Gazals in urdu
27. nusrat qawali offline
28. Nusrat Qawali
29. 200 Top Nusrat songs
30. Punjabi Qawali
31. Hamd e Bari Tala
32. Nusrat Naat
33. Filmi gane
34. Purane Gane
35. Indian Songs
36. Bollywood Songs
37. Hindi Songs
38. Old Songs
39. Muhammad Ali
40. pakistani old dramas
41. pakistani old movies
42. pakistani old songs
43. Sufi Songs
44. Qawali app
45. Sufi Kalams
46. Top Sufi Songs
47. New Qawali
48. Top Sufi Kalams
49. To Qawali Music
50. Nusrat Fateh Ali Khan Ghazal
51. Songs Of Nusrat Fateh Ali Khan
52. Qawali Of Nusrat Fateh Ali Khan
53. Nusrat Fateh Ali Khan Songs Download
54. Nusrat Fateh Ali Khan Qawwali Download
55. Sabri Brothers Qawwali Download
56. Nusrat Fateh Ali Khan Qawwali Download Mp3
57. Rahat Fateh Ali Khan Songs
58. Amjad Sabri Qawwali
59. Rahat Fateh Ali Khan Qawali

Note: if you like our app“Nusrat Fateh Ali Khan Qawallis” then like it and share with your friends. Give us your feedback about this app.

Disclaimer: The content provided in this application“Nusrat Fateh Ali Khan Qawallis” is available free on public domain. We do not host any content. We are just providing the way to stream and all content is the copyright of their respective owner.

How to install Nusrat Fateh Ali Khan Songs & Qawali APK for Android


Download Nusrat Fateh Ali Khan Songs & Qawali APK file (com.activeapp.nusratfatehalikhanqawwali_1_4404675.apk) from APKPure.live, then follow these steps:

Update Phone Settings

  • Go to your phone Settings page
  • Tap Security or Applications (varies with device)
  • Check the Unknown Sources box
  • Confirm with OK

Go to Downloads

  • Open Downloads on your device by going to My Files or Files
  • Tap the APK file you downloaded (com.activeapp.nusratfatehalikhanqawwali_1_4404675.apk)
  • Tap Install when prompted, the APK file you downloaded will be installed on your device.

How to install Nusrat Fateh Ali Khan Songs & Qawali APK on Windows PC 7/8/10/11 or MAC?


Download Nusrat Fateh Ali Khan Songs & Qawali APK file (com.activeapp.nusratfatehalikhanqawwali_1_4404675.apk) from APKPure.live to your PC (ex: C://Users/xxx/Downloads/(com.activeapp.nusratfatehalikhanqawwali_1_4404675.apk), then follow these steps appear on screen.

Using Emulator:

  • Download And Install one Emulator Softwares (Ex: Bluestacks, GenyMotion, NoxPlayer)
  • Simple install APK on PC by drag and drop file com.activeapp.nusratfatehalikhanqawwali_1_4404675.apk on Emulator screen

Nusrat Fateh Ali Khan Songs & Qawali APK Pros & Cons


Pros
  • This app is safe, it's not require high risk permissions
  • Compatible with 32 bit device (most Emulator using 32bit arch CPU)
  • Compatible with 64-bit device (some android device and current Bluestacks)

Cons
Everything is good.


Similar applications


New Apps



Comments

No comment Yet.